PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G26350.1
Common NameLOC102719046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 329aa    MW: 35895.6 Da    PI: 5.9137
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G26350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.1e-5261321128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd+++ + 
  OB10G26350.1   6 LPPGFRFHPTDDELVGYYLKRKVDSLKIEL-EVIPVIDLYKFEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATSTGYWKATGKDRKIAC- 100
                   79****************************.99**************95334445667************************************99. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + gl+ktLvfykgrap ge+tdWvmheyrl
  OB10G26350.1 101 -ADVFGLRKTLVFYKGRAPGGERTDWVMHEYRL 132
                   .779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-583154IPR003441NAC domain
PROSITE profilePS5100557.16155IPR003441NAC domain
PfamPF023655.0E-297132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDS LKIELEVIPV IDLYKFEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATSTGYWK ATGKDRKIAC ADVFGLRKTL VFYKGRAPGG  120
ERTDWVMHEY RLCQDLAHGV SNFIGAYALC RVIKRHEAGL LGEPAAKAKG VVGGGQMSKA  180
SSSSSLVTAD HQLGRGNASP FTPTNASPPL DEMFGGDPFQ LQSCVPYGAG DACVMDLPPL  240
YVPHGQQDPF FSAAGFPPAA ISETQPPFYG DVMGSVSEHE LKWDNLGCSG GSSELCNAAA  300
AGAPLLCRQA SDGDDLTAWF AADDNMSVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-50115912169NAC domain-containing protein 19
4dul_A2e-50115912169NAC domain-containing protein 19
1ut7_B2e-50115912169NO APICAL MERISTEM PROTEIN
1ut7_A2e-50115912169NO APICAL MERISTEM PROTEIN
1ut4_B2e-50115912169NO APICAL MERISTEM PROTEIN
1ut4_A2e-50115912169NO APICAL MERISTEM PROTEIN
3swp_D2e-50115915172NAC domain-containing protein 19
3swp_C2e-50115915172NAC domain-containing protein 19
3swp_B2e-50115915172NAC domain-containing protein 19
3swp_A2e-50115915172NAC domain-containing protein 19
3swm_D2e-50115915172NAC domain-containing protein 19
3swm_C2e-50115915172NAC domain-containing protein 19
3swm_B2e-50115915172NAC domain-containing protein 19
3swm_A2e-50115915172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332460.0CT833246.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI238F12, full insert sequence.
GenBankCT8332470.0CT833247.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI241J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662089.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotA4VCM03e-69NAC45_ARATH; NAC domain-containing protein 45
TrEMBLJ3N5370.0J3N537_ORYBR; Uncharacterized protein
STRINGOB10G26350.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.14e-84NAC domain containing protein 71